PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID MDP0000931057
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Rosales; Rosaceae; Maloideae; Maleae; Malus
Family MYB
Protein Properties Length: 226aa    MW: 25554.7 Da    PI: 10.2638
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
MDP0000931057genomeGDRView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding68.41.2e-212976148
                     TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
  Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
                     +g+WTteEd++l++a++ +G ++WktIa++ g++R++k+c++rw++yl
    MDP0000931057 29 KGAWTTEEDQKLAEAIETHGAKRWKTIASKAGLNRCGKSCRLRWLNYL 76
                     79********************************************97 PP

2Myb_DNA-binding51.72e-1682127148
                      TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
  Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48 
                      rg+ + +E++l+v+++k+lG++ W++Ia +++ gRt++++k++w+++l
    MDP0000931057  82 RGNISDQEEDLIVRLHKLLGNR-WSLIAGRLP-GRTDNEIKNYWNSHL 127
                      78999*****************.*********.************986 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129426.3222480IPR017930Myb domain
SuperFamilySSF466899.56E-3027123IPR009057Homeodomain-like
SMARTSM007171.9E-172878IPR001005SANT/Myb domain
PfamPF002491.0E-192976IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.601.1E-253083IPR009057Homeodomain-like
CDDcd001677.53E-123176No hitNo description
SMARTSM007172.2E-1581129IPR001005SANT/Myb domain
PROSITE profilePS5129420.04481131IPR017930Myb domain
PfamPF002491.7E-1482127IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.601.1E-2484131IPR009057Homeodomain-like
CDDcd001671.51E-986127No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 226 aa     Download sequence    Send to blast
MAPVTKESVN RRKMKGGEAM KNTKRKVNKG AWTTEEDQKL AEAIETHGAK RWKTIASKAG  60
LNRCGKSCRL RWLNYLRPNI KRGNISDQEE DLIVRLHKLL GNRWSLIAGR LPGRTDNEIK  120
NYWNSHLSKR MSQKEKENGA NLTRKMISTD HQKDHVQMKE DASLQEAATS TSTTSAASSA  180
ASKGGDQNSN INIDVDDFFD FSNEGSLNLE WVSKFLEQDY GRWLN*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1h8a_C8e-302713125128MYB TRANSFORMING PROTEIN
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_008351094.11e-167PREDICTED: transcription factor WER-like
TrEMBLM5WVH01e-118M5WVH0_PRUPE; Uncharacterized protein
STRINGPOPTR_0003s06320.15e-86(Populus trichocarpa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF21483288
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G40330.12e-53myb domain protein 23